DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_795998.2 Gene:Tmprss11b / 319875 MGIID:2442893 Length:416 Species:Mus musculus


Alignment Length:293 Identity:94/293 - (32%)
Similarity:140/293 - (47%) Gaps:43/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SSTTSRTTTSRTTVANFPIERDCVTCRCG----LINTLYKIVGGQETRVHQYPWMAVILIYNRFY 125
            |.||...:...|.::....|: .:..|||    :..|..:|.||......::||.|.:.:..:.|
Mouse   146 SLTTDPGSLKLTEISKVDAEK-IINNRCGRRPRMSATYDRITGGSTAHKGEWPWQASLRVNGKHY 209

  Fly   126 CSGSLINDLYVLTAAHCVEGV--PPEL-------ITLRFLEHNRSHSNDDIVIQRYVSRVKVHEL 181
            |..|||.:.::||||||.:|.  |..|       :|..:::|:             |..:.:||.
Mouse   210 CGASLIGERFLLTAAHCFQGTNNPKNLTVSFGTRVTPAYMQHS-------------VQEIIIHED 261

  Fly   182 YNPRSFDNDLAVLRLNQPLDMRH--HRLRPICLPVQSYSFDHELG-IVAGWGAQREGGFGTDTLR 243
            |......:|:||::|.:.:...:  ||   :|||..:..|....| :|.|||:....|.....|:
Mouse   262 YVKGEHHDDVAVIKLTEKVSFNNDVHR---VCLPESTQIFPPGEGVVVTGWGSFSYNGKSPLLLQ 323

  Fly   244 EVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQ---YQL 305
            :..:.::..:.|.:...| .|:|.|.|:||||: ||..|||.|||||||     ..|..   :.|
Mouse   324 KASIKIIDTNTCNSEEAY-GGRIVDTMLCAGYL-EGSIDACQGDSGGPL-----VHPNSRDIWYL 381

  Fly   306 AGIVSWGVGCARPQSPGVYTRVNQYLRWLGSNT 338
            .||||||..|.|...||||.||..|..|:.|.|
Mouse   382 VGIVSWGHECGRVNKPGVYMRVTSYRNWIASKT 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 82/247 (33%)
Tryp_SPc 101..334 CDD:238113 82/247 (33%)
Tmprss11bNP_795998.2 SEA 46..140 CDD:279699
Tryp_SPc 184..410 CDD:214473 82/248 (33%)
Tryp_SPc 185..413 CDD:238113 83/250 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.