DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG32523

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:249 Identity:74/249 - (29%)
Similarity:117/249 - (46%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCV----EGVPPELITLRFLEHNR 160
            :||||.:.:..|:|....:.:....||.|.:|:..:|:||.|||    :.||.:|.:::  ..:.
  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQ--AGSL 98

  Fly   161 SHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPL--DMRHHRLR------PICLPVQSY 217
            ..|:|.:.|.  |:.|.:|..| .....||||||||..||  |.....::      |.|:.|.  
  Fly    99 LLSSDGVRIP--VAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD-- 158

  Fly   218 SFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISEGGKD 282
                    ::|||...|.|..:|:|..|.|..:.:..|| ...|  .::.:.|:|..:....|  
  Fly   159 --------ISGWGNIAEKGPLSDSLLFVQVTSISRGACR-WMFY--SRLPETMICLLHSKNSG-- 210

  Fly   283 ACSGDSGGPLQTTFDEQPGQYQLAGIVS--WGVGCARPQSPGVYTRVNQYLRWL 334
            ||.||||||  .|:..     ::.|:.|  .|.||.| .:|..|.|:::...|:
  Fly   211 ACYGDSGGP--ATYGG-----KVVGLASLLLGGGCGR-AAPDGYLRISKVRAWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 73/246 (30%)
Tryp_SPc 101..334 CDD:238113 73/246 (30%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/247 (30%)
Tryp_SPc 37..219 CDD:238113 61/201 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457784
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.