DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG32376

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:243 Identity:77/243 - (31%)
Similarity:121/243 - (49%) Gaps:31/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRSHSN 164
            :||.|:.....:.|:...:.....|.|...:||.:::|||.||..| |||..|:|.....:....
  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFG-PPEKYTVRVGSDQQRRGG 128

  Fly   165 DDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLP-VQSYSFDHELGIVAG 228
            .    .|:|.::.....||..:..:|||:::|..|:.. ...:||:.|| .::..|..:. :|:|
  Fly   129 Q----LRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYF-GKCVRPVKLPSTKTTKFPKKF-VVSG 187

  Fly   229 WG-----AQREGGFGTDTLREVDVVVLPQSECRNGTTYRPG--QITDNMMCAGYISEGGKDACSG 286
            ||     ||....:    ||.|.:..:.:|:|:.  .|:..  :|..:|:||   |...||:|||
  Fly   188 WGITSANAQNVQRY----LRRVQIDYIKRSKCQK--MYKKAGLKIYKDMICA---SRTNKDSCSG 243

  Fly   287 DSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            ||||||.:       :..|.||||||:|||....||||....:|:.|:
  Fly   244 DSGGPLTS-------RGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 76/240 (32%)
Tryp_SPc 101..334 CDD:238113 76/240 (32%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 76/241 (32%)
Tryp_SPc 66..287 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.