DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Tmprss6

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:251 Identity:109/251 - (43%)
Similarity:150/251 - (59%) Gaps:16/251 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEG---VPPELI 151
            |.|||.....:||||..:...::||.|.:.|..|..|.|:||.|.:|:|||||.:.   ..|.|.
  Rat   566 CDCGLQGPSSRIVGGAMSSEGEWPWQASLQIRGRHICGGALIADRWVITAAHCFQEDSMASPRLW 630

  Fly   152 TLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQS 216
            |: ||...|.:|.....:...|||:.:|..:...|.|.|:|:|:|:.|: :....:||:|||.:|
  Rat   631 TV-FLGKMRQNSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPV-VYSATVRPVCLPARS 693

  Fly   217 YSFDHELG---IVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYISE 278
            :.|  |.|   .:.|||||||||.|:.||::|||.::||..|.....|   |:|..|:|||| .:
  Rat   694 HFF--EPGQHCWITGWGAQREGGPGSSTLQKVDVQLIPQDLCNEAYRY---QVTPRMLCAGY-RK 752

  Fly   279 GGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            |.||||.|||||||  ...|..|::.|||:||||:||.||...||||||.:.:.|:
  Rat   753 GKKDACQGDSGGPL--VCKEPSGRWFLAGLVSWGLGCGRPNFFGVYTRVTRVVNWI 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 104/238 (44%)
Tryp_SPc 101..334 CDD:238113 104/238 (44%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486 109/251 (43%)
Tryp_SPc 576..806 CDD:214473 104/239 (44%)
Tryp_SPc 577..809 CDD:238113 105/240 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.