DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Prss30

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:267 Identity:98/267 - (36%)
Similarity:140/267 - (52%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILI-YNRFYCSGSLINDLYVLTAAHCV-EGVPP 148
            |.:...||......||||||:....|:||...:.| .:...|.||||::::|||||||. ..:.|
Mouse    59 DILPSVCGHSRDAGKIVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFRRSLNP 123

  Fly   149 EL-------ITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYN-PRSFDNDLAVLRLNQPLDMRHH 205
            ..       :||..||   .||.  :|.   |..:.||..|. ..:...|:|:::|:.||  |..
Mouse   124 SFYHVKVGGLTLSLLE---PHST--LVA---VRNIFVHPTYLWADASSGDIALVQLDTPL--RPS 178

  Fly   206 RLRPICLP-VQSYSFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECR-----NGTTYRPG 264
            :..|:||| .|:......:..|.||||.:|....: .|:|:.|.:|...:|.     .|::. .|
Mouse   179 QFTPVCLPAAQTPLTPGTVCWVTGWGATQERDMAS-VLQELAVPLLDSEDCEKMYHTQGSSL-SG 241

  Fly   265 Q--ITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRV 327
            :  |..:|:||||: ||.||:|.|||||||..:.:   ..:...||.|||:|||||..|||||||
Mouse   242 ERIIQSDMLCAGYV-EGQKDSCQGDSGGPLVCSIN---SSWTQVGITSWGIGCARPYRPGVYTRV 302

  Fly   328 NQYLRWL 334
            ..|:.|:
Mouse   303 PTYVDWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 94/250 (38%)
Tryp_SPc 101..334 CDD:238113 93/250 (37%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 94/252 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.