DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Prss22

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:307 Identity:92/307 - (29%)
Similarity:146/307 - (47%) Gaps:44/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 STPVVATTSTTTRRTTTTSSTTSRTTTSRTTVANFPIERDCVTCRCGLINTLYKIVGGQETRVHQ 111
            |.|.:|......|........||..|.|...:...|        .||....|.::|||:::...|
  Rat     4 SRPPLALGGDQFRTLILLVLLTSTATVSAANIRGSP--------DCGKPQQLNRVVGGEDSADAQ 60

  Fly   112 YPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRSHSNDDIVIQRY---- 172
            :||:..||.....:|:|||:.:.:|::||||            |..:....|...:::..:    
  Rat    61 WPWIVSILKNGSHHCAGSLLTNRWVVSAAHC------------FSSNMDKPSPYSVLLGAWKLGN 113

  Fly   173 ---------VSRVKVHELYNPRSFDN-DLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGI-V 226
                     ::.|..|..|:.:...: |:|::||.:|:.. ..|:.|||||..|......... :
  Rat   114 PGPRSQKVGIASVLPHPRYSRKEGTHADIALVRLERPIQF-SERILPICLPDSSVHLPPNTNCWI 177

  Fly   227 AGWGAQREGG--FGTDTLREVDVVVLPQSECRNGTTYRPGQ--ITDNMMCAGYISEGGKDACSGD 287
            ||||:.::|.  ....||:::.|.::....|::......||  ||::|:||||: ||.:|||.||
  Rat   178 AGWGSIQDGVPLPRPQTLQKLKVPIIDPELCKSLYWRGAGQEAITEDMLCAGYL-EGKRDACLGD 241

  Fly   288 SGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            |||||....|:   .:.|.||:|||.|||....|||||.:..:..|:
  Rat   242 SGGPLMCQVDD---HWLLTGIISWGEGCAERNRPGVYTSLLAHRPWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 79/251 (31%)
Tryp_SPc 101..334 CDD:238113 79/251 (31%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 79/252 (31%)
Tryp_SPc 50..288 CDD:238113 80/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.