DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Hpn

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_038958880.1 Gene:Hpn / 29135 RGDID:61982 Length:559 Species:Rattus norvegicus


Alignment Length:291 Identity:97/291 - (33%)
Similarity:136/291 - (46%) Gaps:52/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DC-------VTCR-CGLIN-TLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAH 141
            ||       .||: ||... .:.:|||||::.:.::||...:.......|.|||::..:||||||
  Rat   180 DCPRGRFLTATCQDCGRRKLPVDRIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAAH 244

  Fly   142 CVEGVPPELITLRFLEHNRSHSNDDI-----------VIQRYVSRVKVHELYNP---RSFD---N 189
            |            |.|.||..|...:           .:|..|..|..|..|.|   .:.|   |
  Rat   245 C------------FPERNRVLSRWRVFAGAVARTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSN 297

  Fly   190 DLAVLRLNQPLDMRHHRLRPICLPVQSYSF-DHELGIVAGWGAQREGGFGTDTLREVDVVVLPQS 253
            |:|::.|:..|.:..: ::|:|||....:. |.::..|.|||..:..|.....|:|..|.::...
  Rat   298 DIALVHLSSSLPLTEY-IQPVCLPAAGQALVDGKVCTVTGWGNTQFYGQQAVVLQEARVPIISNE 361

  Fly   254 ECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPG--QYQLAGIVSWGVGCA 316
            .| |...:...||...|.|||| .|||.|||.||||||. ...|...|  :::|.||||||.|||
  Rat   362 VC-NSPDFYGNQIKPKMFCAGY-PEGGIDACQGDSGGPF-VCEDRISGTSRWRLCGIVSWGTGCA 423

  Fly   317 RPQSPGVYTRVNQYLRWL-------GSNTPG 340
            ..:.|||||:|..:..|:       |..|.|
  Rat   424 LARKPGVYTKVIDFREWIFQAIKASGDETLG 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 87/252 (35%)
Tryp_SPc 101..334 CDD:238113 87/252 (35%)
HpnXP_038958880.1 Hepsin-SRCR 92..200 CDD:401275 6/19 (32%)
Tryp_SPc 204..441 CDD:238113 87/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12330
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.