DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Prss34

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:279 Identity:92/279 - (32%)
Similarity:126/279 - (45%) Gaps:51/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LYKIVGGQETRVHQYPWMAVILIYN------RFYCSGSLINDLYVLTAAHCVEGVPPELITLRF- 155
            |..||||......::||...:..||      ...|.||||:..:|||||||||....|....|. 
  Rat    30 LVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQ 94

  Fly   156 LEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDN--------DLAVLRLNQPLDMRHHRLRPICL 212
            :...|.:.||.:        :||.::.....|..        |:|:|:|:..: :...|:.|:.|
  Rat    95 VGQLRLYENDQL--------MKVAKIIRHPKFSEKLSAPGGADIALLKLDSTV-VLSERVHPVSL 150

  Fly   213 PVQSYSF-DHELGIVAGWGAQREGGFGTDT---LREVDVVVLPQSECRNGTTYRPGQ-------- 265
            |..|... ..:...|||||. .||......   ||||.|.::..|:|..  .||...        
  Rat   151 PAASQRISSKKTWWVAGWGV-IEGHRPLPPPCHLREVAVPIVGNSDCEQ--KYRTYSSLDRTTKI 212

  Fly   266 ITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQY 330
            |.|:|:|||.   .|:|:|..||||||...::   ..:...|:||||:||..|..|||||||..|
  Rat   213 IKDDMLCAGM---EGRDSCQADSGGPLVCRWN---CSWVQVGVVSWGIGCGLPDFPGVYTRVMSY 271

  Fly   331 LRWLGSNTPGGCHCMPYPE 349
            |.|:....|      .:||
  Rat   272 LSWIHGYVP------KFPE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 87/259 (34%)
Tryp_SPc 101..334 CDD:238113 87/259 (34%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 88/260 (34%)
Tryp_SPc 33..275 CDD:214473 87/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.