DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Prss29

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:259 Identity:82/259 - (31%)
Similarity:125/259 - (48%) Gaps:33/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NTLYKIVGGQETRVHQYPWMAVILIYNRFY------CSGSLINDLYVLTAAHCVEGVPPELITLR 154
            :.|..||||......::||...:.:|...:      |.||:|:..:|||||||:.....:....|
  Rat    26 DVLVGIVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFR 90

  Fly   155 -FLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPL----DMRHHRLRPICLPV 214
             :|.....:..:.::   .||||.:|..:......:|:|:|:|.|.:    :::..:|.|..|.|
  Rat    91 IYLGQVYLYGGEKLL---KVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLEV 152

  Fly   215 QSYSFDHELGIVAGWG--AQREGGFGTDTLREVDVVVLPQSEC----RNGTTY-RPGQ--ITDNM 270
            ..    .::..|.|||  :..|.......|::|.|.::..:.|    ||.|.. ..||  |..:|
  Rat   153 TK----KDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDM 213

  Fly   271 MCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            :|||   ..|:|:|.|||||||....   .|.:.|.|:||||.|||....||||.||..:|.|:
  Rat   214 LCAG---SHGRDSCYGDSGGPLVCNV---TGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 80/252 (32%)
Tryp_SPc 101..334 CDD:238113 80/252 (32%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.