DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Prss27

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:268 Identity:87/268 - (32%)
Similarity:126/268 - (47%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVE-----GVPPELI 151
            ||......::|||::....::||...|......:|.||||...:|||||||..     .:...|:
  Rat    29 CGHPRMFNRMVGGEDALEGEWPWQVSIQRNGAHFCGGSLIAPTWVLTAAHCFSNTSDISIYQVLL 93

  Fly   152 TLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQS 216
            ....|:....|:     :...|.|||.|..|...:...|:|::.|..|:....:.| |:|||..|
  Rat    94 GALKLQQPGPHA-----LYVPVKRVKSHPEYQGMASSADVALVELQVPVTFTKYIL-PVCLPDPS 152

  Fly   217 YSFDHELGI-VAGWGAQREGGFGTD------TLREVDVVVLPQSECRNGTTYRPG--------QI 266
            ..|...:.. |.|||:..|    .|      .|:::.|.::...:|  ...|...        .|
  Rat   153 VVFKSGMNCWVTGWGSPSE----QDRLPNPRILQKLAVPLIDTPKC--NLLYSKDAEADIQLKTI 211

  Fly   267 TDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYL 331
            .|:|:|||: :||.||||.|||||||....|:   .:..||::|||.||||...||||.||..:.
  Rat   212 KDDMLCAGF-AEGKKDACKGDSGGPLVCLVDQ---SWVQAGVISWGEGCARRNRPGVYIRVASHY 272

  Fly   332 RWLGSNTP 339
            :|:....|
  Rat   273 QWIHQIIP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 83/252 (33%)
Tryp_SPc 101..334 CDD:238113 83/252 (33%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 83/253 (33%)
Tryp_SPc 39..278 CDD:238113 84/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.