DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Prss30

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:256 Identity:93/256 - (36%)
Similarity:131/256 - (51%) Gaps:40/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KIVGGQETRVHQYPWMAVILIYNRFY-CSGSLINDLYVLTAAHC-------------VEGVPPEL 150
            ||||||:....::||...:......: |.||||::::|||||||             |.|     
  Rat    30 KIVGGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGG----- 89

  Fly   151 ITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLP-V 214
            :||...|   .||.  :|..|.:.....: |:...| ..|:|:|||:.||  :..:..|:||| .
  Rat    90 LTLSLTE---PHST--LVAVRNIFVYPTY-LWEDAS-SGDIALLRLDTPL--QPSQFSPVCLPQA 145

  Fly   215 QSYSFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRN----GTTYRPGQ--ITDNMMCA 273
            |:......:..|.||||..|....: .|:|:.|.:|...:|..    |.|...|:  |..:|:||
  Rat   146 QAPLTPGTVCWVTGWGATHERELAS-VLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCA 209

  Fly   274 GYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            |:: ||.||:|.|||||||....:   ..:...||.|||:|||||..|||||||..|:.|:
  Rat   210 GFV-EGQKDSCQGDSGGPLVCAIN---SSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 92/253 (36%)
Tryp_SPc 101..334 CDD:238113 91/253 (36%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.