DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG33226

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:281 Identity:84/281 - (29%)
Similarity:129/281 - (45%) Gaps:59/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHC----- 142
            ::.:||....|:..   :|:||....:..:|||..||.....:|.||||:.|:|||||||     
  Fly    32 LDPNCVQTPVGVRE---QILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSRYR 93

  Fly   143 -------VEGVPPELITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDN-DLAVLRLNQP 199
                   ..|:.|     |:|..::..|.....|.  |.|:.:|..|  |.:.| |:|:..|.:|
  Fly    94 LKVRFGRYSGITP-----RYLCSSQYCSPFGPEID--VKRIFLHSSY--RDYHNYDIALFLLAKP 149

  Fly   200 LDMRHH-RLRPICLPVQSYSFD---HELGIVA-----GWGAQREGGFGTDTLREVDVVVLPQSEC 255
              :|:: :.||||: :|:.:.|   ..|..||     ||| :.|....:..|:...:..|.:..|
  Fly   150 --VRYNVQTRPICV-LQTSNKDKLRQFLNYVAMFNVTGWG-KTESQLTSTILQTTSLFHLDRKFC 210

  Fly   256 RNGTTYRPGQITDNM-----MCAGYISEGGKDACSGDSGGPL--QTTFDEQPGQYQLAGIVSWGV 313
                    .||.|..     :|||:   .....|:|||||||  :.||.... :..|.||:|:|.
  Fly   211 --------AQIFDRKIGWPHICAGH---SQSSTCTGDSGGPLSAELTFSGVK-RTVLFGIISYGA 263

  Fly   314 GCARPQSPGVYTRVNQYLRWL 334
            ...|..:  |:|.|.:|..|:
  Fly   264 PNCREVT--VFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 80/261 (31%)
Tryp_SPc 101..334 CDD:238113 80/261 (31%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 81/263 (31%)
Tryp_SPc 47..282 CDD:214473 80/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.