DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and TPSG1

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:268 Identity:92/268 - (34%)
Similarity:128/268 - (47%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRSHSN 164
            :||||.......:||.|.:.:.....|.|||::..:|||||||..|      :|...::......
Human    62 RIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHCFSG------SLNSSDYQVHLGE 120

  Fly   165 DDIVIQRYVSRVKVHELYNPRS----FDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGI 225
            .:|.:..:.|.|:...|::..|    ...|:|::.|:.|:.: ..|:.|:|||..|..|..  ||
Human   121 LEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTL-SSRILPVCLPEASDDFCP--GI 182

  Fly   226 ---VAGWGAQREG-----GFGTDTLREVDVVVLPQSECR------NGTTYRPGQITDNMMCAGYI 276
               |.|||..|||     .:   :||||.|.|:....||      .|:..:|     :|:||   
Human   183 RCWVTGWGYTREGEPLPPPY---SLREVKVSVVDTETCRRDYPGPGGSILQP-----DMLCA--- 236

  Fly   277 SEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSN-TPG 340
             .|..|||..||||||....:   |.:..||.||||.||.||..|||||||..|:.|:..: |..
Human   237 -RGPGDACQDDSGGPLVCQVN---GAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITAS 297

  Fly   341 GCHCMPYP 348
            |.....||
Human   298 GGSESGYP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 87/250 (35%)
Tryp_SPc 101..334 CDD:238113 87/250 (35%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 87/251 (35%)
Tryp_SPc 63..293 CDD:238113 88/253 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.