DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG30288

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:282 Identity:91/282 - (32%)
Similarity:133/282 - (47%) Gaps:48/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RTTTSRTTVANFPIERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDL 134
            ||.:.|.      :|.||.|........  :|.||::..:...|||..::|..:..|.||||...
  Fly    20 RTESGRL------LENDCGTTSSNGYRA--RIDGGRDAGMESNPWMVRVMISGKAVCGGSLITAR 76

  Fly   135 YVLTAAHCVEGVPPELITLRFLEHNRSH---SNDDIVI--QRY---VSRVKVHELYNPRSFDNDL 191
            :||||.||:.   |..:.:|..|::..|   ..||.|.  :.|   |.|..||.  ||   ..|:
  Fly    77 FVLTAEHCIS---PMYMNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVHS--NP---GYDI 133

  Fly   192 AVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGIV----AGWGAQREGGFGTDTLREVDVVVLPQ 252
            .:||:.:.:...:: :|||||.:......:.|.|:    .|||...:|. ..|.|:...:..|||
  Fly   134 GLLRMQRSVIFSNY-VRPICLILGKTLGGNPLSILRFNFTGWGTNSDGE-EQDRLQTATLQQLPQ 196

  Fly   253 SECRNGTTYRPGQITD-NMMCAG-YISEGGKDACSGDSGGPLQT--TFDEQPGQYQLAGIVSWGV 313
            ..|.     |||:..| :.:||| |||    |:|.|||||||..  ||:.|...:|. |:.|.|:
  Fly   197 WSCE-----RPGRPLDISYICAGSYIS----DSCKGDSGGPLSAIRTFEGQGRVFQF-GVASQGL 251

  Fly   314 G-CARPQSPGVYTRVNQYLRWL 334
            . |:   ..|:||.|..:..|:
  Fly   252 RLCS---GLGIYTNVTHFTDWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 83/249 (33%)
Tryp_SPc 101..334 CDD:238113 83/249 (33%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 83/250 (33%)
Tryp_SPc 45..270 CDD:238113 82/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.