DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG30287

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:279 Identity:80/279 - (28%)
Similarity:125/279 - (44%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IERDCVTCRC--GLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEG 145
            ::..|||.|.  |    ||:::.|:...:...|||.:|:......|.||||...||||||||...
  Fly    26 LDPQCVTARSEPG----LYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSE 86

  Fly   146 VPPELITLRFLEHNRSHSNDDIVIQRY--VSR---VKVHELYNPRSF----DNDLAVLRLNQPLD 201
            ...:| |:|..:::   .|..:....|  :.|   :.|...|.|..:    .||:|:|||...:.
  Fly    87 TKSQL-TVRLGDYD---VNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQ 147

  Fly   202 MRHHRLRPICLPVQSYSFDHEL--GIV----AGWGAQREGGFGTDTLREVDVVVLPQSECRN--G 258
            ...: :|.|||.:..|::...:  .:|    .||| :.|....:..|::..:.....|.|..  |
  Fly   148 YGDN-IRSICLLMGDYTWSSNILKNLVKFNTTGWG-RTESRINSPVLQQASLTHHHLSYCAQVFG 210

  Fly   259 TTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQ---LAGIVSWG-VGCARPQ 319
            .     |:..:.:|   ::......|.|||||||  |...:.|..:   |.|:||:| |.|.   
  Fly   211 K-----QLDKSHIC---VASSTGSTCQGDSGGPL--TARVRIGSERRVILFGVVSYGAVHCF--- 262

  Fly   320 SPGVYTRVNQYLRWLGSNT 338
            .|.|||.|..:..|:..:|
  Fly   263 GPTVYTNVIHFANWIELHT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 71/253 (28%)
Tryp_SPc 101..334 CDD:238113 71/253 (28%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/254 (28%)
Tryp_SPc 42..280 CDD:238113 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.