DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG30088

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:276 Identity:88/276 - (31%)
Similarity:131/276 - (47%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 ANFPIERDCVTCRCGL---INTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAA 140
            |||.|.      .||:   .|...:||.|:|..:...|:||.:...:..:|.|::|:..|:||||
  Fly    26 ANFLIP------SCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIHCGGTIISSRYILTAA 84

  Fly   141 HCVEGVPPELITLRFLEHNRSHSND-------------DIVIQRYVSRVKVHELYNPRSFDNDLA 192
            ||:.    ..:.:|..||:.:.:.|             |||:.....|.       .|...||:|
  Fly    85 HCMR----PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRF-------DRFLANDIA 138

  Fly   193 VLRLNQPLDMRHHRLRPICL---PVQSYSFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSE 254
            :|:|::.:....| ::||||   |..:.:. ||.. ..||| |.|.....:.|:...:.......
  Fly   139 LLKLSRNIRFNVH-IQPICLILNPAAAPNV-HEFQ-AFGWG-QTETNHSANVLQTTVLTRYDNRH 199

  Fly   255 CRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFD-EQPGQYQLAGIVSWGVGCARP 318
            ||:..:.   .||.|.:|.|:   .|.|.|||||||||.|..: :...:|...||||:|..  :.
  Fly   200 CRSVLSM---PITINQLCVGF---QGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDD--KC 256

  Fly   319 QSPGVYTRVNQYLRWL 334
            |||||||.|..|:||:
  Fly   257 QSPGVYTYVPNYIRWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 79/249 (32%)
Tryp_SPc 101..334 CDD:238113 80/249 (32%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 80/250 (32%)
Tryp_SPc 45..273 CDD:238113 81/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.