DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and CG30083

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:259 Identity:81/259 - (31%)
Similarity:130/259 - (50%) Gaps:44/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGLINTLYKIVGGQETRVHQYPWMAVILIYN-----RFYCSGSLINDLYVLTAAHCVEGVPPELI 151
            ||..:...||:.||.......||||.|..||     ...|.|:||:..:||:||||::  ..:::
  Fly    25 CGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIK--RDQIL 87

  Fly   152 TLRFLEHNRSHSNDDIVIQRYVSRVKV--HELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICL-- 212
            .:|..||:.|         ||.:..|.  ::.:...|:.||:.:||: ||:...:..:||||:  
  Fly    88 AVRLGEHSSS---------RYFAVTKAFRNKYFTTGSYSNDIGILRI-QPIVKFNAVIRPICIIT 142

  Fly   213 ------PVQSYSFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMM 271
                  .|:::.       .||||......| :..|:.|::..|..|||.|....   .:|::.:
  Fly   143 DPTKVPNVKTFK-------AAGWGKTENETF-SKVLKTVELNELNASECYNMLWV---NVTESQI 196

  Fly   272 CAGYISEGGKDACSGDSGGPL-QTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            |||: .:|  |.|:||||||| ...:.:...:|...||:|:|....  .|||||||::.::.|:
  Fly   197 CAGH-PDG--DTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC--NSPGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 78/248 (31%)
Tryp_SPc 101..334 CDD:238113 77/248 (31%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 78/249 (31%)
Tryp_SPc 34..255 CDD:238113 77/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.