DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_766468.1 Gene:Tmprss11e / 243084 MGIID:3513175 Length:423 Species:Mus musculus


Alignment Length:336 Identity:106/336 - (31%)
Similarity:154/336 - (45%) Gaps:56/336 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RIRPNEG-----KIFEWLGSILLPSTTTTTSTPVVATTSTTTRRTTTTSSTT-----SRTTTSRT 76
            |||..|.     ||.|:   :|.......|..|.|...|...::...|.|..     ..|..:::
Mouse   123 RIRSTEDPETVHKIIEY---VLHEKLKYATGPPNVDPESVKIKKINKTESDNYFNHCCGTRRNKS 184

  Fly    77 TVANFPIERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAH 141
            ||                 .|..:||||......::||.:.:.......|..:|||:.:::||||
Mouse   185 TV-----------------QTSVRIVGGTPVEEEEWPWQSSLRWDGSHRCGATLINNTWLVTAAH 232

  Fly   142 CVEGVPPELITLRFLEH---NRSHSNDDIVIQ-----RYVSRVKVHELYNPRSFDNDLAVLRLNQ 198
            |            |..|   :|..:.....:|     ..:.|:.|||.|...|.|.|:|:..|::
Mouse   233 C------------FRTHKDPSRWSATFGATLQPRKLTTGIRRIIVHEKYKYPSHDYDIALAELSK 285

  Fly   199 PLDMRHHRLRPICLPVQSYSFD-HELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYR 262
            |:... :.:..:|||..::.|. .:...|.|:||.:..||..:.||:|.|..:....|....:|.
Mouse   286 PVPCT-NAVHKVCLPDANHEFQPGQRMFVTGFGALKNDGFTQNNLRQVQVDYIDTQTCNQPQSYN 349

  Fly   263 PGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRV 327
             |.||..|:|||:: :|.||||.||||||| .|.|.:...| |||:||||..|.:|..|||||||
Mouse   350 -GAITPRMLCAGFL-KGEKDACQGDSGGPL-VTADVRDIWY-LAGVVSWGDECGQPNKPGVYTRV 410

  Fly   328 NQYLRWLGSNT 338
            ..:..|:.|||
Mouse   411 TAFRHWIASNT 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 84/241 (35%)
Tryp_SPc 101..334 CDD:238113 84/241 (35%)
Tmprss11eNP_766468.1 SEA 50..145 CDD:279699 8/24 (33%)
Tryp_SPc 191..417 CDD:214473 84/242 (35%)
Tryp_SPc 192..420 CDD:238113 85/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.