DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and TPSD1

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:214 Identity:72/214 - (33%)
Similarity:102/214 - (47%) Gaps:38/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 IVGGQETRVHQYPWMAVILI---YNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRF-LEHNRS 161
            ||||||....::||...:.:   |...:|.||||:..:|||||||||....:|..||. |.....
Human    38 IVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHL 102

  Fly   162 HSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGI- 225
            :..|.::   .|||:.||..:.......|:|:|.|.:|:::..| :..:.||..|.:|...:.. 
Human   103 YYQDQLL---PVSRIIVHPQFYIIQTGADIALLELEEPVNISSH-IHTVTLPPASETFPPGMPCW 163

  Fly   226 VAGWGAQREGGFGTDT---------LREVDVVVLPQSECRNGTTYRPGQ--------ITDNMMCA 273
            |.|||       ..|.         |:||:|.|:....|  ...|..|.        :.|:|:||
Human   164 VTGWG-------DVDNNVHLPPPYPLKEVEVPVVENHLC--NAEYHTGLHTGHSFQIVRDDMLCA 219

  Fly   274 GYISEGGKDACSGDSGGPL 292
            |  || ..|:|.|||||||
Human   220 G--SE-NHDSCQGDSGGPL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 72/214 (34%)
Tryp_SPc 101..334 CDD:238113 72/214 (34%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 72/214 (34%)
Tryp_SPc 38..240 CDD:214473 72/214 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.