DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Prss27

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:278 Identity:86/278 - (30%)
Similarity:132/278 - (47%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFL 156
            ||......::|||:.....::||...|......:|.||||...:|||||||.             
Mouse    29 CGHPKMFNRMVGGENALEGEWPWQVSIQRNGIHFCGGSLIAPTWVLTAAHCF------------- 80

  Fly   157 EHNRSHSNDDIVIQRYVSRVKV-----HELY--------NPR----SFDNDLAVLRLNQPLDMRH 204
                |:::|..:.|..:..:|:     |.||        ||:    :...|:|::.|..|:...:
Mouse    81 ----SNTSDISIYQVLLGALKLQQPGPHALYVPVKQVKSNPQYQGMASSADVALVELQGPVTFTN 141

  Fly   205 HRLRPICLPVQSYSFDHELGI-VAGWGAQREGGFGTD------TLREVDVVVLPQSECR------ 256
            :.| |:|||..|..|:..:.. |.|||:..|    .|      .|:::.|.::...:|.      
Mouse   142 YIL-PVCLPDPSVIFESGMNCWVTGWGSPSE----QDRLPNPRVLQKLAVPIIDTPKCNLLYNKD 201

  Fly   257 NGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSP 321
            ..:.::...|.|:|:|||: :||.||||.|||||||....|:   .:..||::|||.||||...|
Mouse   202 VESDFQLKTIKDDMLCAGF-AEGKKDACKGDSGGPLVCLVDQ---SWVQAGVISWGEGCARRNRP 262

  Fly   322 GVYTRVNQYLRWLGSNTP 339
            |||.||..:.:|:....|
Mouse   263 GVYIRVTSHHKWIHQIIP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 82/262 (31%)
Tryp_SPc 101..334 CDD:238113 82/262 (31%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 82/263 (31%)
Tryp_SPc 39..278 CDD:238113 83/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.