DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Tmprss15

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_032967.1 Gene:Tmprss15 / 19146 MGIID:1197523 Length:1069 Species:Mus musculus


Alignment Length:248 Identity:85/248 - (34%)
Similarity:138/248 - (55%) Gaps:21/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KIVGGQETRVHQYPWMAVILIY------NRFYCSGSLINDLYVLTAAHCV--EGVPPELITLRFL 156
            |||||.:.:...:||  |:.:|      :|..|..||::..::::|||||  ..:.|...|....
Mouse   829 KIVGGSDAQAGAWPW--VVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLG 891

  Fly   157 EHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSF-D 220
            .|.:|:.....|::|.|.::.::..|:.|...||:|::.|...::...: ::|||||.::..| .
Mouse   892 LHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDY-IQPICLPEENQIFIP 955

  Fly   221 HELGIVAGWGAQR-EGGFGTDTLREVDVVVLPQSECRNG-TTYRPGQITDNMMCAGYISEGGKDA 283
            .....:||||..: ..|...|.|:|.||.::...:|:.. ..|   .||::|:|||| .|||.|:
Mouse   956 GRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEY---NITESMICAGY-EEGGIDS 1016

  Fly   284 CSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGS 336
            |.|||||||..   ::..::.|.|:.|:||.||.|..||||.||:|::.|:.|
Mouse  1017 CQGDSGGPLMC---QENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHS 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 83/243 (34%)
Tryp_SPc 101..334 CDD:238113 82/243 (34%)
Tmprss15NP_032967.1 SEA 53..154 CDD:214554
LDLa 228..261 CDD:197566
CUB 270..376 CDD:294042
MAM 392..549 CDD:279023
MAM 392..547 CDD:99706
CUB 569..676 CDD:278839
LDLa 688..722 CDD:238060
SR 723..816 CDD:214555
SRCR 728..819 CDD:278931
Tryp_SPc 829..1064 CDD:214473 83/244 (34%)
Tryp_SPc 830..1066 CDD:238113 83/245 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 184 1.000 Domainoid score I3400
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11120
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.