DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and try-3

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:264 Identity:73/264 - (27%)
Similarity:122/264 - (46%) Gaps:49/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 YKIVGGQETRVHQYPWMAVILIY----NRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFL--- 156
            ::|:||.... ....|||.::.|    ....|..::|:|.:::|||||.    .:|.|..|:   
 Worm    36 FRIIGGNSID-DGANWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCA----LQLQTRSFVYVR 95

  Fly   157 --EHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSF 219
              ::||..|..       |....:|..||.::.|||:|:||::.  |:....::|:||.......
 Worm    96 EPKNNRERSFS-------VKEAYIHSGYNNQTADNDIALLRISS--DLSKLGIKPVCLVHDDSKL 151

  Fly   220 --DHELGIVAGWG---AQREGG----FGTDTLREVDVVVLPQSECRNGTTYR-----PGQITDNM 270
              .::.|:|.|:|   .:...|    ..:.||:...|.::...:|..  |:|     ..:||...
 Worm   152 LKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVK--TWRFLSLLSVKITGYQ 214

  Fly   271 MCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVG-----CARPQSPGVYTRVNQY 330
            :|||....|   ...|||||||  ...:..|:|...||.|:|..     ..:.:.||||||:::|
 Worm   215 ICAGAYLHG---TAPGDSGGPL--LIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKY 274

  Fly   331 LRWL 334
            :.|:
 Worm   275 VPWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 72/260 (28%)
Tryp_SPc 101..334 CDD:238113 72/260 (28%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 73/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.