DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and try-1

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:245 Identity:95/245 - (38%)
Similarity:136/245 - (55%) Gaps:25/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 YKIVGGQETRVHQYPWMAVILI---YNRFYCSGSLINDLYVLTAAHC-VEGVPPELITLRFLEHN 159
            ::::||.|:..|.:||...:|.   ::|  |.||||:..:||||||| .:...|...::|...| 
 Worm    56 HRLIGGSESSPHSWPWTVQLLSRLGHHR--CGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGGH- 117

  Fly   160 RSHSNDDIVIQRYVSRVKVHELYN---PRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDH 221
            ||.|..    ...|:.|.:|..||   |.|:  |.|::|::.|:: .....|||||| ...:.::
 Worm   118 RSGSGS----PHRVTAVSIHPWYNIGFPSSY--DFAIMRIHPPVN-TSTTARPICLP-SLPAVEN 174

  Fly   222 ELGIVAGWGAQREG-GFGTDTLREVDVVVLPQSECRNGTTYRPGQI-TDNMMCAGYISEGGKDAC 284
            .|.:|.|||:..|| .....||||:.|.:|....|.:...| .|:| ..:|:|||| |.|..|:|
 Worm   175 RLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNY-IGRIHLPSMLCAGY-SYGKIDSC 237

  Fly   285 SGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            .|||||||....|   |.::|.|:||||:|||||..||||..|:....|:
 Worm   238 QGDSGGPLMCARD---GHWELTGVVSWGIGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 94/241 (39%)
Tryp_SPc 101..334 CDD:238113 94/241 (39%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 95/242 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.