DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Tpsb2

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:262 Identity:92/262 - (35%)
Similarity:124/262 - (47%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 IVGGQETRVHQYPWMAVI---LIYNRFYCSGSLINDLYVLTAAHCVEGVP----PELITLRFLEH 158
            ||||.|....::||...:   |.|...:|.||||:..:||||||||.  |    |:|..::..|.
Mouse    32 IVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVG--PHIKSPQLFRVQLREQ 94

  Fly   159 NRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHEL 223
            ...:.:..:.:.|.|    ||..|.......|:|:|.|..|:::..| |.||.||..|.:|....
Mouse    95 YLYYGDQLLSLNRIV----VHPHYYTAEGGADVALLELEVPVNVSTH-LHPISLPPASETFPPGT 154

  Fly   224 GI-VAGWGAQREGGFGTD-------TLREVDVVVLPQSECRNGTTYRPGQIT--------DNMMC 272
            .. |.||     |....|       .|::|.|.::..|.|  ...|..|..|        |.|:|
Mouse   155 SCWVTGW-----GDIDNDEPLPPPYPLKQVKVPIVENSLC--DRKYHTGLYTGDDFPIVHDGMLC 212

  Fly   273 AGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSN 337
            ||   ...:|:|.|||||||..   :..|.:..||:||||.|||:|..||:||||..||.|:...
Mouse   213 AG---NTRRDSCQGDSGGPLVC---KVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHRY 271

  Fly   338 TP 339
            .|
Mouse   272 VP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 90/254 (35%)
Tryp_SPc 101..334 CDD:238113 90/255 (35%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 91/257 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842978
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.