DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:270 Identity:100/270 - (37%)
Similarity:146/270 - (54%) Gaps:32/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCV--EGVPPELIT 152
            |.|||.....:||||..:...::||.|.:.:..|..|.|:||.|.:|:|||||.  :.:...::.
Human   557 CDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADRWVITAAHCFQEDSMASTVLW 621

  Fly   153 LRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSY 217
            ..||.....:|.....:...|||:.:|..:...|.|.|:|:|:|:.|: :|...:||:|||.:|:
Human   622 TVFLGKVWQNSRWPGEVSFKVSRLLLHPYHEEDSHDYDVALLQLDHPV-VRSAAVRPVCLPARSH 685

  Fly   218 SFDHELGI-VAGWGAQREGGF--------------GTDT--------LREVDVVVLPQSECRNGT 259
            .|:..|.. :.||||.|||..              |::|        |::|||.::||..|....
Human   686 FFEPGLHCWITGWGALREGALRADAVALFYGWRNQGSETCCCPISNALQKVDVQLIPQDLCSEVY 750

  Fly   260 TYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVY 324
            .|   |:|..|:|||| .:|.||||.|||||||  ......|::.|||:||||:||.||...|||
Human   751 RY---QVTPRMLCAGY-RKGKKDACQGDSGGPL--VCKALSGRWFLAGLVSWGLGCGRPNYFGVY 809

  Fly   325 TRVNQYLRWL 334
            ||:...:.|:
Human   810 TRITGVISWI 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 95/257 (37%)
Tryp_SPc 101..334 CDD:238113 95/257 (37%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486 100/270 (37%)
Tryp_SPc 568..822 CDD:238113 96/259 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6128
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40976
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.