DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Tmprss2

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_008766769.1 Gene:Tmprss2 / 156435 RGDID:620766 Length:580 Species:Rattus norvegicus


Alignment Length:263 Identity:82/263 - (31%)
Similarity:124/263 - (47%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 CVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVE------- 144
            |:.|....:....:||||.......:||...:.:.....|.||:|...:::|||||||       
  Rat   240 CIECGVRSVRRQSRIVGGSTASPGDWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEEPLSSPR 304

  Fly   145 ------GVPPELITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMR 203
                  |:..:.:......|.             |.:|..|..|:.::.:||:|:::|..||.. 
  Rat   305 YWTAFAGILKQSLMFYGSRHQ-------------VEKVISHPNYDSKTKNNDIALMKLQTPLAF- 355

  Fly   204 HHRLRPICLPVQSYSFD--HELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQI 266
            :..::|:|||......|  .|..| :||||..|.|..:|.|....|.::..|:|.:...|. ..|
  Rat   356 NDVVKPVCLPNPGMMLDLAQECWI-SGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYN-NLI 418

  Fly   267 TDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYL 331
            |..|:|||:: :|..|:|.|||||||.|..:|   .:.|.|..|||.|||:...||||..|..:.
  Rat   419 TPAMICAGFL-QGSVDSCQGDSGGPLVTLKNE---IWWLIGDTSWGSGCAKAYRPGVYGNVTVFT 479

  Fly   332 RWL 334
            .|:
  Rat   480 DWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 79/247 (32%)
Tryp_SPc 101..334 CDD:238113 79/247 (32%)
Tmprss2XP_008766769.1 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:292133 2/6 (33%)
Tryp_SPc 253..482 CDD:214473 79/248 (32%)
Tryp_SPc 254..485 CDD:238113 80/249 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.