DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Hpn

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001263198.1 Gene:Hpn / 15451 MGIID:1196620 Length:445 Species:Mus musculus


Alignment Length:278 Identity:94/278 - (33%)
Similarity:133/278 - (47%) Gaps:45/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DC-------VTCR-CGLIN-TLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAH 141
            ||       .||: ||... .:.:|||||::.:.::||...:.......|.|||::..:||||||
Mouse   167 DCPRGRFLTATCQDCGRRKLPVDRIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAAH 231

  Fly   142 CVEGVPPELITLRFLEHNRSHSNDDI-----------VIQRYVSRVKVHELYNP---RSFD---N 189
            |            |.|.||..|...:           .:|..|..|..|..|.|   .:.|   |
Mouse   232 C------------FPERNRVLSRWRVFAGAVARTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSN 284

  Fly   190 DLAVLRLNQPLDMRHHRLRPICLPVQSYSF-DHELGIVAGWGAQREGGFGTDTLREVDVVVLPQS 253
            |:|::.|:..|.:..: ::|:|||....:. |.::..|.|||..:..|.....|:|..|.::...
Mouse   285 DIALVHLSSSLPLTEY-IQPVCLPAAGQALVDGKVCTVTGWGNTQFYGQQAMVLQEARVPIISNE 348

  Fly   254 ECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPG--QYQLAGIVSWGVGCA 316
            .| |...:...||...|.|||| .|||.|||.||||||. ...|...|  :::|.||||||.|||
Mouse   349 VC-NSPDFYGNQIKPKMFCAGY-PEGGIDACQGDSGGPF-VCEDSISGTSRWRLCGIVSWGTGCA 410

  Fly   317 RPQSPGVYTRVNQYLRWL 334
            ..:.|||||:|..:..|:
Mouse   411 LARKPGVYTKVTDFREWI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 87/252 (35%)
Tryp_SPc 101..334 CDD:238113 87/252 (35%)
HpnNP_001263198.1 Hepsin-SRCR 78..187 CDD:255261 6/19 (32%)
Tryp_SPc 190..428 CDD:214473 87/253 (34%)
Tryp_SPc 191..428 CDD:238113 87/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11120
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.