DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Tmprss3

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:260 Identity:88/260 - (33%)
Similarity:134/260 - (51%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VTCRCGLINTLY----KIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPP 148
            ||.:|....|..    :||||..:.:.|:||...:.......|.||:|..|:::||||||..   
Mouse   222 VTLKCSACGTRTGYSPRIVGGNMSSLTQWPWQVSLQFQGYHLCGGSIITPLWIVTAAHCVYD--- 283

  Fly   149 ELITLRFLEHNRSHS--------NDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHH 205
                   |.|.:|.:        .|..|....|.::..|..|.|:...||:|:::|::||.. ..
Mouse   284 -------LYHPKSWTVQVGLVSLMDSPVPSHLVEKIIYHSKYKPKRLGNDIALMKLSEPLTF-DE 340

  Fly   206 RLRPICLPVQSYSF-DHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDN 269
            .::|||||....:| |.:|...:||||..:||..:..|....|.::....|.:...| .|.|:.:
Mouse   341 TIQPICLPNSEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVY-GGIISPS 404

  Fly   270 MMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            |:||||: :||.|:|.|||||||..   ::...::|.|..|:|:|||....||||||:..:|.|:
Mouse   405 MLCAGYL-KGGVDSCQGDSGGPLVC---QERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 465

  Fly   335  334
            Mouse   466  465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 83/241 (34%)
Tryp_SPc 101..334 CDD:238113 83/241 (34%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133 4/10 (40%)
Tryp_SPc 238..465 CDD:214473 83/242 (34%)
Tryp_SPc 239..468 CDD:238113 84/243 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11120
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.