DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and TMPRSS11B

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:261 Identity:87/261 - (33%)
Similarity:128/261 - (49%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CG--LINTLY---KIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELI 151
            ||  :.|::.   |||.|:.:....:||.|.:....|.||..|||:..::|:||||         
Human   171 CGRQVANSIITGNKIVNGKSSLEGAWPWQASMQWKGRHYCGASLISSRWLLSAAHC--------- 226

  Fly   152 TLRFLEHNRSHS---NDDIVIQ-----RYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLR 208
               |.:.|.|..   |..||:.     |.|..:..||.|:.....:|:|:::|.:.:....: :|
Human   227 ---FAKKNNSKDWTVNFGIVVNKPYMTRKVQNIIFHENYSSPGLHDDIALVQLAEEVSFTEY-IR 287

  Fly   209 PICLPVQSYSF-DHELGIVAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMC 272
            .||||...... :::..:|.|||.....|.....|:|..:.::....|.....| .|.:||.|:|
Human   288 KICLPEAKMKLSENDNVVVTGWGTLYMNGSFPVILQEDFLKIIDNKICNASYAY-SGFVTDTMLC 351

  Fly   273 AGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSN 337
            ||::| |..|||..||||||  .:.:....:.|.||||||.||.:...|||||||..|..|:.|.
Human   352 AGFMS-GEADACQNDSGGPL--AYPDSRNIWHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWITSK 413

  Fly   338 T 338
            |
Human   414 T 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 81/241 (34%)
Tryp_SPc 101..334 CDD:238113 80/241 (33%)
TMPRSS11BNP_872308.2 SEA 45..143 CDD:279699
Tryp_SPc 184..410 CDD:214473 81/242 (33%)
Tryp_SPc 185..413 CDD:238113 81/244 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41415
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.