DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Prss28

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:255 Identity:73/255 - (28%)
Similarity:118/255 - (46%) Gaps:37/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 IVGGQETRVHQYPWMAVILIYNR------FYCSGSLINDLYVLTAAHCVEGVPPELITLR----- 154
            |||||.|...::||...:.:|:.      ..|.||:|:..::||||||::....:....|     
Mouse    31 IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGE 95

  Fly   155 -FLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYS 218
             :|...:...|        :||:.:|..||..|...|||:::|...| :....:.|:.||..|.:
Mouse    96 VYLYKEQELLN--------ISRIIIHPDYNDVSKRFDLALMQLTALL-VTSTNVSPVSLPKDSST 151

  Fly   219 FDH-ELGIVAGWG--AQREGGFGTDTLREVDVVVLPQSEC------RNGTTYRPGQITDNMMCAG 274
            ||. :...:.|||  .||........|.||.:.:.....|      ::...::...|.|:|:|||
Mouse   152 FDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAG 216

  Fly   275 YISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
               ..|:..|.|||||||...   :..::...|:||.|:.|:. ..|.:::||...|.|:
Mouse   217 ---TSGRGPCFGDSGGPLVCW---KSNKWIQVGVVSKGIDCSN-NLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 72/252 (29%)
Tryp_SPc 101..334 CDD:238113 72/253 (28%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 73/255 (29%)
Tryp_SPc 31..269 CDD:214473 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843002
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.