DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:328 Identity:106/328 - (32%)
Similarity:153/328 - (46%) Gaps:36/328 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TTTTTSTPVVATTSTTTRRTTTTSSTTSRTTTSRTTVA---------NFPIERDCVTCR------ 91
            |.|.::.....|..:|...:...|..|:...||...|.         :..::..|:...      
Zfish   227 TYTQSAESGYDTNGSTVFYSIPVSDVTNLPYTSNVNVKGRWVFRVDNSSEVKGSCINTNSQALDS 291

  Fly    92 -----CGLI--NTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPE 149
                 ||:|  |:....||||.:....:||.|.:..|:...|.|||||..:||:||||..|....
Zfish   292 PSAAVCGIIPVNSSNGTVGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNG 356

  Fly   150 LITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPV 214
            ......|.....:..|...|.|.|..|..|..|||.:.|||:|::||:.|:... ..:||:||..
Zfish   357 FYLTVILGPKTQNKYDPSRISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFT-DSIRPVCLAA 420

  Fly   215 QSYSFDHEL-GIVAGWGAQREGG--FGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYI 276
            :...|:.:. ..:..|....:|.  ......:||:|.|:...:|  ...|..|.|||||:|||.:
Zfish   421 EGSVFNSDTESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQC--NCLYGVGSITDNMICAGLL 483

  Fly   277 SEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLG----SN 337
            .| |||.|.||||||:   ...|...:..:||||:|.|||:.:.|||||||::|..|:.    |:
Zfish   484 KE-GKDLCQGDSGGPM---VSNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWITYFTCSD 544

  Fly   338 TPG 340
            .||
Zfish   545 PPG 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 88/235 (37%)
Tryp_SPc 101..334 CDD:238113 88/235 (37%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 9/44 (20%)
Tryp_SPc 309..537 CDD:238113 88/234 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587881
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.