DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and LOC101734975

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_004918402.1 Gene:LOC101734975 / 101734975 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:250 Identity:80/250 - (32%)
Similarity:121/250 - (48%) Gaps:39/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 QYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRSHSNDDIVIQRY--- 172
            :.||...:.......|.|||||:.:.::||||..|      .:|..::.       :.:..|   
 Frog     4 EIPWQLSLRKLGLHICGGSLINNQWAISAAHCFAG------PIRVSDYK-------VNLGAYQLS 55

  Fly   173 --------VSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELG-IVAG 228
                    |:.|.||..:.......|:|:::|..|:....: :.|:|:|.|:..|...:. ||:|
 Frog    56 VPSGIFVDVAAVYVHPTFKGAGSIGDIALIKLANPVQFTDY-IIPVCIPTQNVVFPDGMNCIVSG 119

  Fly   229 WGA--QREGGFGTDTLREVDVVVLPQSECR-----NGTTYRPGQ--ITDNMMCAGYISEGGKDAC 284
            ||.  |:.......||::|.|.::.::.|.     |..|..|.|  |..:|:|||| ..|.:.:|
 Frog   120 WGTINQQVSLPYPKTLQKVRVPIIGRASCDQMYHINNPTLPPYQSIIMWDMICAGY-KAGRRGSC 183

  Fly   285 SGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSNTP 339
            .|||||||...::   |.:.||||||||.|||:|..|||||.|..|..|:....|
 Frog   184 QGDSGGPLVCPWN---GSWLLAGIVSWGFGCAQPNKPGVYTSVPAYSAWIQEYVP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 78/242 (32%)
Tryp_SPc 101..334 CDD:238113 78/243 (32%)
LOC101734975XP_004918402.1 Tryp_SPc 2..232 CDD:238113 79/245 (32%)
Tryp_SPc 2..230 CDD:214473 78/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.