DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and tmprss2.14

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_031752402.1 Gene:tmprss2.14 / 101731505 XenbaseID:XB-GENE-22065937 Length:504 Species:Xenopus tropicalis


Alignment Length:342 Identity:103/342 - (30%)
Similarity:152/342 - (44%) Gaps:53/342 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NEGKI-FEWLGSILLPSTTTTTSTPVVATTSTT----TRRTTTTSSTTSRTTTSRTTVANFPIER 85
            |.||| .:.:|.    ||:|...:..::.:|:.    .:.:|.|....:....|.|..:...:..
 Frog   190 NSGKIACQDIGY----STSTYYESSHLSASSSNGYFMLQSSTVTGKLYNHLHYSATCASGNMVSL 250

  Fly    86 DCVTCRCGLINTL-YKIVGGQETRVHQYPWMAVILI---YNRFYCSGSLINDLYVLTAAHCVEGV 146
            .|::  |||...: .:||||.......:||...:|.   .:.:.|.||:|...:|:||||||.|.
 Frog   251 RCIS--CGLSTKVDSRIVGGTVASAGDWPWQVQLLKRVGASLYLCGGSIITQHWVVTAAHCVYGS 313

  Fly   147 PPELITLRFLEHNRSHSNDDIVIQRY------VSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHH 205
            .......:...       ..:.||.|      |.|..||..|:..:.:.|:|:|:|...|....:
 Frog   314 TSTPSAFKVFA-------GSLTIQSYYSAGYTVERALVHPSYSSYTQNYDVALLKLTAALVFTTN 371

  Fly   206 RLRPICLPVQSYSFDHELGI---------VAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTY 261
             |||:|||        .:|:         ::|||....||..:..|:...|.::..:.|.....|
 Frog   372 -LRPVCLP--------NVGMPWAEGQPCWISGWGTTSNGGSISTNLKAASVPLISSATCNQAAVY 427

  Fly   262 RPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTR 326
             .|.|:..||||||:| ||.|.|.|||||||.|   :....:.|.|..|||.||.....||||..
 Frog   428 -GGAISPTMMCAGYLS-GGTDTCQGDSGGPLVT---KTNSLWWLVGDTSWGYGCGMTNKPGVYGN 487

  Fly   327 VNQYLRWLGS--NTPGG 341
            :...|.|:.|  .|.||
 Frog   488 LTFSLEWIYSEMQTYGG 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 81/250 (32%)
Tryp_SPc 101..334 CDD:238113 81/250 (32%)
tmprss2.14XP_031752402.1 LDLa <96..121 CDD:238060
LDLa 128..159 CDD:238060
SRCR_2 164..259 CDD:406055 17/74 (23%)
Tryp_SPc 265..497 CDD:238113 82/252 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.