DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and Tpsab1

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:275 Identity:92/275 - (33%)
Similarity:135/275 - (49%) Gaps:31/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PIERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVIL---IYNRFYCSGSLINDLYVLTAAHCV 143
            |:....|....|...|...||||||...:::||...:.   .|...:|.||||:..:||||||||
Mouse    10 PLLSSLVHAAPGPAMTREGIVGGQEAHGNKWPWQVSLRANDTYWMHFCGGSLIHPQWVLTAAHCV 74

  Fly   144 --EGVPPELITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHR 206
              :...|..:.:: |.....:.:|.::.   ||::..|..:.......|:|:|:|..|:::..: 
Mouse    75 GPDVADPNKVRVQ-LRKQYLYYHDHLMT---VSQIITHPDFYIVQDGADIALLKLTNPVNISDY- 134

  Fly   207 LRPICLPVQSYSF-DHELGIVAGWGAQREGGFGTD---TLREVDVVVLPQSECRNGTTYRPGQIT 267
            :.|:.||..|.:| ...|..|.||| ..:.|....   .|:||.|.::....|  ...|..|.||
Mouse   135 VHPVPLPPASETFPSGTLCWVTGWG-NIDNGVNLPPPFPLKEVQVPIIENHLC--DLKYHKGLIT 196

  Fly   268 --------DNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVY 324
                    |:|:|||   ..|.|:|.|||||||....::   .:..||:||||.|||:|..||:|
Mouse   197 GDNVHIVRDDMLCAG---NEGHDSCQGDSGGPLVCKVED---TWLQAGVVSWGEGCAQPNRPGIY 255

  Fly   325 TRVNQYLRWLGSNTP 339
            |||..||.|:....|
Mouse   256 TRVTYYLDWIHHYVP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 86/249 (35%)
Tryp_SPc 101..334 CDD:238113 86/249 (35%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 87/250 (35%)
Tryp_SPc 29..265 CDD:214473 86/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.