DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and LOC100495541

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_031749237.1 Gene:LOC100495541 / 100495541 -ID:- Length:659 Species:Xenopus tropicalis


Alignment Length:351 Identity:103/351 - (29%)
Similarity:147/351 - (41%) Gaps:84/351 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 WLGSI-LLPSTTTTTSTPVVATTSTTTRRTTTTSSTTSRTTTSRTTVANFPIERDC--------- 87
            ||.|. ...:|....|.|       ||...|..|:.:|..:.|::.    |:...|         
 Frog   280 WLSSYNATENTVNVDSVP-------TTAPPTLISNVSSLFSLSKSA----PLPGACSLLCIWLIA 333

  Fly    88 ---------------VTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVL 137
                           .|..||......:||||.:.....:||...:..:....|.||||...:::
 Frog   334 MAKDSSVSPSVSDTTSTLSCGSPLVSNRIVGGTDATDGAWPWQVSLDYHGSHICGGSLIATQWIM 398

  Fly   138 TAAHCVEGVPPELITLRFLEHNRSHSNDDIVIQRY-VSRVKVHELY-----------NPRSFDND 190
            |||||             .|:::|.|:..|.:..| :|.:..||:.           |..|.:.|
 Frog   399 TAAHC-------------FEYSKSPSDYKIRLGAYQLSLISPHEITSTVDSIIVNSPNSSSTNTD 450

  Fly   191 LAVLRLNQPLDMRHHRLRPICLPVQSYSFDHELGI-VAGWG--AQREGGFGTDTLREVDVVVLPQ 252
            :|::||..|:....:.| |||||..|..|...:.. |.|||  |.:.......||::|...::.:
 Frog   451 IALIRLTSPITYTKYIL-PICLPSTSDGFTEGMECWVTGWGTIASQVNLPYPMTLQQVMTPLISR 514

  Fly   253 SECRNGTTYRPGQITDNMM---------CAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGI 308
            :.|..  .|.    ||:::         |||| :.|.||:|.|||||||....  |...||: ||
 Frog   515 ATCNQ--MYN----TDSLLSVVVPLDQICAGY-AAGQKDSCQGDSGGPLVCQL--QGIWYQI-GI 569

  Fly   309 VSWGVGCARPQSPGVYTRVNQYLRWL 334
            ||||.|||....|||||.|..|..|:
 Frog   570 VSWGEGCAVRNRPGVYTLVPAYYSWV 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 85/256 (33%)
Tryp_SPc 101..334 CDD:238113 85/256 (33%)
LOC100495541XP_031749237.1 Tryp_SPc 44..283 CDD:238113 2/2 (100%)
Tryp_SPc 362..595 CDD:238113 85/256 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.