DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and prss8l.5 loc108703873

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_002939739.1 Gene:prss8l.5 loc108703873 / 100494289 XenbaseID:XB-GENE-22167980 Length:353 Species:Xenopus tropicalis


Alignment Length:263 Identity:87/263 - (33%)
Similarity:138/263 - (52%) Gaps:24/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGV-PPELITLR 154
            :||......:|:|||:::...:||...|...:..:|.||||...:|::|:||.... ||...|:.
 Frog    26 QCGTRQVSTRIMGGQDSQQGMWPWQVNIRSNDFSFCGGSLITSKWVISASHCFNRTNPPSFYTVY 90

  Fly   155 FLEHNRSHSNDD---IVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQS 216
            ...:..:.:|.:   :.|||::    ||..|....:.:|:.::.|:..::..:: ::|:|||...
 Frog    91 LGSYQLTGANGNEIPMAIQRFI----VHPNYTSPEYGHDITLVELSSDVNFTNY-IQPVCLPSAG 150

  Fly   217 YSFDHELGI-VAGWG--AQREGGFGTDTLREVDVVVLPQSECRNGTTYRPG-------QITDNMM 271
            .:|...|.. |.|||  |........:||::|.|.::...:| |.....|.       .|.::|:
 Frog   151 VNFPTGLQCWVTGWGNIASNVSLRDPNTLQQVAVPLIGNQQC-NSILQAPSPLGPSSFAILNDML 214

  Fly   272 CAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGS 336
            ||||| :||||:|.|||||||...   ...|:.|.|:||:|.||.:|..||||.||..||.|:.|
 Frog   215 CAGYI-DGGKDSCQGDSGGPLVCA---AANQWYLVGVVSFGDGCGQPNRPGVYVRVTAYLDWIES 275

  Fly   337 NTP 339
            ..|
 Frog   276 YIP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 82/246 (33%)
Tryp_SPc 101..334 CDD:238113 82/246 (33%)
prss8l.5 loc108703873XP_002939739.1 Tryp_SPc 35..273 CDD:214473 82/247 (33%)
Tryp_SPc 36..275 CDD:238113 83/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.