DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and LOC100491119

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_004916446.1 Gene:LOC100491119 / 100491119 -ID:- Length:512 Species:Xenopus tropicalis


Alignment Length:342 Identity:99/342 - (28%)
Similarity:151/342 - (44%) Gaps:65/342 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RPNEGKIFEWLGSILLPSTTTTTSTPVVATTST-----TTRRTTTTSSTTSRTTTSRTTVANFP- 82
            :|:.|    |.....|...:.|.|:||:.:..:     .......|..|.:...|..:.|...| 
 Frog   194 KPSHG----WTVCRELGFNSHTMSSPVLLSAMSPIVLEAFAIVNKTDGTPNNLETFMSPVDICPT 254

  Fly    83 ---IERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVE 144
               :...|..|....:: :.:||||.::.:.::||...:....|..|.||:|:..:|::||||  
 Frog   255 QEGVSLQCTDCGQASVD-IPRIVGGTDSSLGKWPWQVSLRWDGRHMCGGSIISSQWVMSAAHC-- 316

  Fly   145 GVPPELITLRFLEHNRSHSNDDIVIQRYVSRVKVHE--------------------LYNPRSFDN 189
                 .:...||.               |||.|:|.                    ||:..:.|.
 Frog   317 -----FVLNGFLT---------------VSRWKIHAGSISLSTGIAYSVRNIYYNGLYSLETNDY 361

  Fly   190 DLAVLRLNQPLDMRHHRLRPICLP--VQSYSFDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQ 252
            |:|:|:...|:.. ....||:|||  .|.:.......|: |||...|||..:..|:|..|.::..
 Frog   362 DVALLKTTVPMSF-SDTTRPVCLPRAYQQFQVTANCWII-GWGHVSEGGQLSPVLQEAKVQLISS 424

  Fly   253 SECRNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCAR 317
            ..|.:.:.| .|||:..|:|||| .:|..|:|.|||||||..   ::.|.:...||||||.||.|
 Frog   425 QICNHSSNY-AGQISPRMLCAGY-PDGRADSCQGDSGGPLVC---QEGGLWWQVGIVSWGEGCGR 484

  Fly   318 PQSPGVYTRVNQYLRWL 334
            |..|||||.:.:.|.|:
 Frog   485 PNRPGVYTNLTEVLDWV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 83/254 (33%)
Tryp_SPc 101..334 CDD:238113 83/254 (33%)
LOC100491119XP_004916446.1 SRCR_2 172..269 CDD:373897 15/78 (19%)
Tryp_SPc 275..501 CDD:238113 83/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.