DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and tmprss6

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:266 Identity:90/266 - (33%)
Similarity:145/266 - (54%) Gaps:11/266 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TVANFPIERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAH 141
            ::|:.|...|...|.||:.....::|||.:.:..::||.|.:.:.....|.|:|:.|.::|||||
 Frog   547 SIADCPDGSDENNCGCGIQAVGIRLVGGTQAQEGEWPWQASLQVRGEHICGGTLVADQWILTAAH 611

  Fly   142 CV---EGVPPELITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMR 203
            |.   ....||:.|: :|...|...:....:...|.|:.:|..|:..|.|.|:|::.|:..:.:.
 Frog   612 CFTPESYASPEVWTV-YLGKVRLSRSTQKELAFKVIRLVIHPFYDEDSHDYDVALVLLDHLVPLT 675

  Fly   204 HHRLRPICLPVQSYSFDHELGI-VAGWGAQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQIT 267
            ...::|||||..::.|...... |.|||:.:|.|..:|.|::||:.::.|..|.....|   ||:
 Frog   676 SPHVQPICLPSSTHHFPTGSSCWVTGWGSVKENGPTSDVLQKVDIQLVAQDICTELYRY---QIS 737

  Fly   268 DNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLR 332
            ..|:|||| .:|.||||.||||.||  ......|::..||:||||.||..|:..|||:|:.:.::
 Frog   738 PRMLCAGY-RDGSKDACQGDSGSPL--VCKTASGRWFQAGLVSWGAGCGIPRYFGVYSRITRLVQ 799

  Fly   333 WLGSNT 338
            |:.|.|
 Frog   800 WIESIT 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 81/236 (34%)
Tryp_SPc 101..334 CDD:238113 81/236 (34%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060
LDLa 480..514 CDD:238060
LDLa 525..560 CDD:238060 3/12 (25%)
Tryp_SPc 572..804 CDD:238113 82/238 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.