DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and hpn

DIOPT Version :10

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_012811934.1 Gene:hpn / 100145343 XenbaseID:XB-GENE-995348 Length:417 Species:Xenopus tropicalis


Alignment Length:83 Identity:14/83 - (16%)
Similarity:26/83 - (31%) Gaps:34/83 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly  1721 TLSDPQAKNEKDRYLSKKKQQRAPPSISVGVKASHLSEIGGHSLHLHYHHSSFSHGGEHSPHA-- 1783
            |.|.||...:.:.:||:.:..:.|....:.                  .|:.:::.|..:.||  
 Frog    18 TASGPQLNAQLEGWLSQVQSTKRPARAIIA------------------PHAGYTYCGSCAAHAYK 64

  Fly  1784 --------------PHHH 1787
                          |.||
 Frog    65 QVDPSITRRIFILGPSHH 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 101..334 CDD:238113
hpnXP_012811934.1 Hepsin-SRCR 50..159 CDD:462736 6/33 (18%)
Tryp_SPc 163..400 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.