DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and zgc:165423

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:260 Identity:96/260 - (36%)
Similarity:143/260 - (55%) Gaps:22/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DCVTCR----CGL--INTLYKIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVE 144
            ||...:    ||.  :||  |||||.......:||.|.:......:|.||||:|.::|:||||..
Zfish    19 DCQPTQSPPACGKAPLNT--KIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFP 81

  Fly   145 GVP-PELITLRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLR 208
            ..| |...|:.....::...|.: .:.:.||:|.||.||...:.|||:|:|.|:.|:...:: ::
Zfish    82 SNPNPSDYTVYLGRQSQDLPNPN-EVSKSVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNY-IQ 144

  Fly   209 PICLPVQSYSFDHELGIVAGWGAQREGGF--GTDTLREVDVVVLPQSECRNGTTYRPG-QITDNM 270
            |:||.....:|.::...:.|||....|..  ....|:||:|.::..:.|  ...|..| .||:||
Zfish   145 PVCLAADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLC--NCLYGGGSSITNNM 207

  Fly   271 MCAGYISEGGKDACSGDSGGPLQ-TTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL 334
            |||| :.:||||:|.||||||:. .:|:    .:..||:||:|.|||.|..||||.||:||..|:
Zfish   208 MCAG-LMQGGKDSCQGDSGGPMVIKSFN----TWVQAGVVSFGKGCADPNYPGVYARVSQYQNWI 267

  Fly   335  334
            Zfish   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 89/237 (38%)
Tryp_SPc 101..334 CDD:238113 88/237 (37%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 89/238 (37%)
Tryp_SPc 38..269 CDD:238113 89/239 (37%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587883
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.