DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9294 and zgc:163079

DIOPT Version :9

Sequence 1:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:271 Identity:92/271 - (33%)
Similarity:136/271 - (50%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGL--INTLYKIVGGQETRVHQYPWMAVILI--YNRFYCSGSLINDLYVLTAAHCVEGVPPELIT 152
            ||.  :||  ||:||.......:||.|.|.:  ...|||.|||||..:|||.|.....:|...|.
Zfish    27 CGRAPLNT--KIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIV 89

  Fly   153 LRFLEHNRSHSNDDIVIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSY 217
            : :|.....:.::...|.|.|:::..|..||  |.|::||:|:|:.|:....: ::|:||.....
Zfish    90 V-YLGRQTQNGSNPYEISRTVTKIIKHPNYN--SLDSNLALLKLSSPVTFSDY-IKPVCLAAAGS 150

  Fly   218 SF-DHELGIVAGWG-----AQREGGFGTDTLREVDVVVLPQSECRNGTTYRPGQITDNMMCAGYI 276
            .| |.....|.|||     |..|.....|.|:||:..::...||  ...| .|.||:.::||||:
Zfish   151 VFVDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFEC--NAAY-GGIITNKLLCAGYL 212

  Fly   277 SEGGKDACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWL----GSN 337
            :|.||..|:||.||||..   :|...:..:|:|..|. |..|..|.:|.||::|..|:    .|:
Zfish   213 NEDGKAPCAGDVGGPLVI---KQGAIWIQSGVVVSGY-CGLPGYPTIYVRVSEYEDWISYYTNSS 273

  Fly   338 TPGGCHCMPYP 348
            .||   .:.||
Zfish   274 LPG---FVSYP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 82/240 (34%)
Tryp_SPc 101..334 CDD:238113 81/240 (34%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 82/241 (34%)
Tryp_SPc 36..267 CDD:238113 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587753
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.