DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4372 and si:dkey-103j14.5

DIOPT Version :9

Sequence 1:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_005156981.3 Gene:si:dkey-103j14.5 / 570552 ZFINID:ZDB-GENE-090313-170 Length:361 Species:Danio rerio


Alignment Length:332 Identity:83/332 - (25%)
Similarity:139/332 - (41%) Gaps:69/332 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AWSVLQQGPRRTRQAVIQGCMACQNQRCGRLLTGRSSPDT------------------------E 108
            |||:    |....::.:.|..|........|.||||:.|.                        .
Zfish    65 AWSI----PDALAESSVAGVKAAARAGDAVLRTGRSAIDAVETAVRCLEDDPTFDAGHGSVLNIS 125

  Fly   109 GALTLEAAIMDGESLEYGAVAGMNGVRNAILVADAVLKYTKHSVLVGKSATKFARSLGYKEEYLT 173
            |.:.|::.|||||:|..||||.:..:.|.:.:|.||::.|.|.:|..:.|:.||..:|....:  
Zfish   126 GEVELDSIIMDGETLAAGAVASVRNIANPVSLARAVMEKTDHVMLTDRGASMFAEHIGTPVAH-- 188

  Fly   174 DARTRNVLKKWRSNGCQPNFWRDVHPSPAENCGPYSPLPEHMHQHPMH-QEYAIIQGQHDQLAFL 237
            |..|....|:|                            ||...:|.. :::...|..||.:..:
Zfish   189 DLVTELERKEW----------------------------EHSKSYPDGVKKFFNTQWGHDTVGAV 225

  Fly   238 ALDAEGKFHVASQSSGAQFRIPGRVGDSAVPGAGIYADNEVGGAVASGDGDVLMRHLPAFLAVEA 302
            |||:.|....|:.:.|.:.::.||||||.:.|:|.||||..|....:|.|:.:::...|.|.:..
Zfish   226 ALDSSGNVACATSTGGIRNKMVGRVGDSPIIGSGGYADNRSGAVSCTGHGESILKVTLARLILFH 290

  Fly   303 MRAGKEPDKAAELVVQRLLRHNTEFNGAVVVVNRRGIYAA-------ACAGLDE--FHFVVSGGK 358
            :..||....|||..:| .:....:..|..|:::..|.:.|       |.|.:.|  .|:.::..:
Zfish   291 VEQGKSAVGAAEASLQ-YMSQRVKGCGGAVLLSSTGDWTASFTTPRMAWASVKEDILHYGLNPKE 354

  Fly   359 EYLSMAR 365
            .:..|.:
Zfish   355 HFTEMLK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 82/321 (26%)
si:dkey-103j14.5XP_005156981.3 ASRGL1_like 56..344 CDD:271338 80/313 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.