DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4372 and aga

DIOPT Version :9

Sequence 1:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001103751.1 Gene:aga / 566517 ZFINID:ZDB-GENE-040426-2311 Length:337 Species:Danio rerio


Alignment Length:310 Identity:125/310 - (40%)
Similarity:191/310 - (61%) Gaps:18/310 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LLISTWNYTDANLQAWSVLQQGPRRTRQAVIQGCMACQNQRCGRLLTGRSSPDTEGALTLEAAIM 118
            |:|:||.:.||...||..|::| .....||.:||..|:..:|...:....|||..|..||:|.||
Zfish    21 LVINTWRFEDAAGAAWKALEKG-SSVLDAVERGCAYCELVQCDGSVGFGGSPDERGETTLDAMIM 84

  Fly   119 DGESLEYGAVAGMNGVRNAILVADAVLKYTKHSVLVGKSATKFARSLGYKEEYLTDARTRNVLKK 183
            :|:::|.||||.:..|:||:.||.||:::::|:.:||:|||.||:::|:..|.|:..::..:..:
Zfish    85 NGDTMEVGAVADLRRVKNAVGVARAVMEHSEHTFIVGESATIFAQNMGFTSEDLSTNKSIAIFSQ 149

  Fly   184 WRSNGCQPNFWRDVHPSPAENCGPYSP-LPEHMHQHPMHQEYAIIQG-----QHDQLAFLALDAE 242
            |....||||:.::|.|.|:::||||.| ..:.|.:||        :|     .||.:..:.:..:
Zfish   150 WLQQNCQPNYRKNVSPDPSKSCGPYKPKAKQWMSKHP--------RGNFDPRSHDTIGMVVIGRQ 206

  Fly   243 GKFHVASQSSGAQFRIPGRVGDSAVPGAGIYADNEVGGAVASGDGDVLMRHLPAFLAVEAMRAGK 307
            |:...|:.::||..:||||||||.|.|||.|||:.||||.|:||||::||.||:|||||.||.|.
Zfish   207 GQVAAATSTNGATHKIPGRVGDSPVAGAGAYADSTVGGAAATGDGDIMMRFLPSFLAVELMRNGA 271

  Fly   308 EPDKAAELVVQRLLRHNTEFNGAVVVVNRRGIYAAAC---AGLDEFHFVV 354
            :|..|....:.|:.::..:|.|||:..|..|.|.|||   .|..:|.|:|
Zfish   272 QPTVACRTAINRIKKYYPDFFGAVICANTAGDYGAACNKRPGFSQFPFMV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 125/310 (40%)
agaNP_001103751.1 Glycosylasparaginase 21..323 CDD:271335 125/310 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574710
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487354at2759
OrthoFinder 1 1.000 - - FOG0004212
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.