DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4372 and TASP1

DIOPT Version :9

Sequence 1:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_060184.2 Gene:TASP1 / 55617 HGNCID:15859 Length:420 Species:Homo sapiens


Alignment Length:403 Identity:91/403 - (22%)
Similarity:134/403 - (33%) Gaps:168/403 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ACQNQ----RCGRLLTG---------RSSPDTE----------GALTLEAAIMDGESLEYGAVAG 130
            |||..    :.|.|.|.         ..||.|.          |.:..:|:||||:||.:|||..
Human    68 ACQKAIEKLQAGALATDAVTAALVELEDSPFTNAGMGSNLNLLGEIECDASIMDGKSLNFGAVGA 132

  Fly   131 MNGVRNAILVADAVL------KYTKHSV----LVGKSATKFA----------------------- 162
            ::|::|.:.||:.:|      |.:...:    |||:.|.::|                       
Human   133 LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPSCPPNIMTTRFSLAAFK 197

  Fly   163 ---RSLGYKEEYLTDARTRNVLKKWRSNGCQPNFWRDVHPSPAENCGPYSPLPEHMHQHPMHQEY 224
               |.|...|...||...   |||.|.:            |..||                    
Human   198 RNKRKLELAERVDTDFMQ---LKKRRQS------------SEKEN-------------------- 227

  Fly   225 AIIQGQHDQLAFLALDAEGKFHVASQSSGAQFRIPGRVGDSAVPGAGIYADNEVGGA-------- 281
              ..|..|.:..:.:|.||....|..|.|...:.|||||.:|:.|.|.:|:|.  ||        
Human   228 --DSGTLDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENT--GAHNPYSTAV 288

  Fly   282 VASGDGDVLMRHLPA----------------------------FLAVE-----------AMRAGK 307
            ..||.|:.|:|.:.|                            |||.|           :.|...
Human   289 STSGCGEHLVRTILARECSHALQAEDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCRCSA 353

  Fly   308 EPDKAAE---LVVQRLLRHNTEFNGAVVVVNRRGIYAAACAGLDEFHFVVSGGKEYLSMARVERV 369
            |||.:..   |:|:.|..|.||               :.|.|    :.....||....::|:. .
Human   354 EPDSSQNKQTLLVEFLWSHTTE---------------SMCVG----YMSAQDGKAKTHISRLP-P 398

  Fly   370 KCLERENEVIDGG 382
            ..:..::..|:||
Human   399 GAVAGQSVAIEGG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 85/375 (23%)
TASP1NP_060184.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Taspase1_like 42..416 CDD:271336 91/403 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.