DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4372 and TAF1B

DIOPT Version :9

Sequence 1:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001262451.1 Gene:TAF1B / 41242 FlyBaseID:FBgn0037792 Length:872 Species:Drosophila melanogaster


Alignment Length:470 Identity:86/470 - (18%)
Similarity:142/470 - (30%) Gaps:165/470 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WNYTDANLQA---------------------WSV-----------LQQGPRRTRQAVIQGCMACQ 91
            ||.|..||.|                     ||:           |:...:.:|.:  :|.|:|.
  Fly   179 WNRTKRNLDASGYRSHGGASESEGEQSLHLQWSMRARKSLKRHMPLKHLDKHSRDS--KGSMSCH 241

  Fly    92 NQRCGRLLTGRSSPDTEGALTLEAAIMDGESLEYGAVAG--MNGVRNAILVADAVLKY------T 148
            :.|          |..:.....:..|.....::...|.|  :|.|.:.|.::| :|::      |
  Fly   242 SLR----------PRVKQLHNFDRNIYCLNIIKLYVVLGIALNMVEDDIQLSD-LLRFIDEEHLT 295

  Fly   149 KH---SVLVGKSATKFARSLGYKEEYLTDARTRNVLKKWRSN-GCQPNFWR-------------- 195
            |.   :.|.|..|.|....|  |:..|:..:.:...|..|.| .|...|..              
  Fly   296 KRCMLNYLPGNVAAKGKALL--KDMELSKMKDKVTNKLLRVNIACMSRFINLSEYQKPNLHSLAE 358

  Fly   196 --------------------DVHPSPAENCGPYSPLPEHMHQHPMHQEYAI-------------- 226
                                |:||....|.....|.|.:..:...:..||:              
  Fly   359 RYILELALPPRLLKYVNSLLDLHPPTFFNAMTVHPYPRYEARTMAYILYAMKLLFGLDDLKERNI 423

  Fly   227 -------------IQGQHDQLAFLALD----AEGKFHVAS---QSSGAQFRIPGRVG---DSAVP 268
                         :.|....|.|:..:    .|.:..:.|   ||...:|.:..|.|   |..: 
  Fly   424 SESAAKINEKLLEVGGDEAPLLFVFTEWMEFVEMRKVIVSHYNQSFARRFGVSTRTGCQVDDIL- 487

  Fly   269 GAGIYADNEVGGAVASGDGDVLMR--HLPAFLAVEAM------RAGKEPDKAAELVVQ------- 318
             |..:.:.|.|.......|...|:  |......:|.|      .:.||..:...:..|       
  Fly   488 -AKEWKEKEQGETFGWMQGSAAMKRQHENLTHIIETMLKDHFGESSKESMEKEHIEFQPSLTPAH 551

  Fly   319 ----RLLRHNTEFNGA---VVVVNRRGIYAAACAGLDEFHFVVSGGKEYLSM----ARVERVKCL 372
                |:|...:..:||   :.:.:...:..:| ..||.|....:...:|||.    .|||.:.|.
  Fly   552 SYFNRILLQVSRSDGAKMKITIPDHMKVDHSA-RNLDPFVLETTELSQYLSQHGLKLRVEELACQ 615

  Fly   373 ERENEVIDGGPKGLF 387
            |....|      |:|
  Fly   616 EDIQNV------GIF 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 75/433 (17%)
TAF1BNP_001262451.1 RRN7 8..40 CDD:288614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.