DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4372 and CG10474

DIOPT Version :9

Sequence 1:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_611404.1 Gene:CG10474 / 37211 FlyBaseID:FBgn0034427 Length:341 Species:Drosophila melanogaster


Alignment Length:327 Identity:137/327 - (41%)
Similarity:196/327 - (59%) Gaps:12/327 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LLISTWNYTDANLQAWSVL---QQGPRRTRQAVIQGCMACQNQRCGRLLTGRSSPDTEGALTLEA 115
            ::|:||.:.:|..:||.:|   :.|..:||.||:.|...|:..:|.:.:....:||..|..:|:|
  Fly     1 MVINTWPFAEAKKEAWRLLNVKKGGLGQTRSAVVGGISMCEKLQCAKTVGYGGNPDERGDTSLDA 65

  Fly   116 AIMDGESLEYGAVAGMNGVRNAILVADAVLKYTKHSVLVGKSATKFARSLGYKEEYLTDARTRNV 180
            .:|||.::|.|||..:..:|:||.||..||::|.|::|||..|.:||.::|.:.|.|........
  Fly    66 LLMDGGTMEVGAVGDLRRIRSAIKVAQHVLEHTLHTLLVGDGADEFANAMGLQYESLNSEDNIES 130

  Fly   181 LKKWRSNGCQPNFWRDVHPSPAENCGPYSPLPEHMHQHPMHQEYAIIQGQHDQLAFLALDAEGKF 245
            ||.|..:.|||||||:|||.|..:||||.||..............|....||.:...|:|.||..
  Fly   131 LKNWTRHNCQPNFWRNVHPDPRTSCGPYQPLVTWDPNAKQSDRIEIGPDNHDTITMAAIDEEGHI 195

  Fly   246 HVASQSSGAQFRIPGRVGDSAVPGAGIYADNEVGGAVASGDGDVLMRHLPAFLAVEAMRAGKEPD 310
            ||.:.::|.::.:||||||:::||:..|||||||.||.:||||:|||.||:.||||||||||.|.
  Fly   196 HVGTSTNGLRYTLPGRVGDASIPGSAAYADNEVGAAVTTGDGDILMRFLPSLLAVEAMRAGKTPA 260

  Fly   311 KAAELVVQRLLRHNTEFNGAVVVVNRRGIYAAACAGL------DEFHFVVSGGKEYLSMARVERV 369
            :|.|||:||:.:|...|..||:|.||.|.||..|.|.      .:|.::||...:   ..|.|.|
  Fly   261 EAVELVIQRIQKHVKYFEVAVIVANRLGTYAVRCHGTGMARDNGKFAYMVSSPGQ---PVRTESV 322

  Fly   370 KC 371
            :|
  Fly   323 EC 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 132/310 (43%)
CG10474NP_611404.1 Glycosylasparaginase 1..312 CDD:271335 132/310 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439399
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3395
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487354at2759
OrthoFinder 1 1.000 - - FOG0004212
OrthoInspector 1 1.000 - - otm3298
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.