DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4372 and Tasp1

DIOPT Version :9

Sequence 1:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_017447248.1 Gene:Tasp1 / 311468 RGDID:1308591 Length:438 Species:Rattus norvegicus


Alignment Length:334 Identity:76/334 - (22%)
Similarity:124/334 - (37%) Gaps:93/334 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GALTLEAAIMDGESLEYGAVAGMNGVRNAILVADAVL------KYTKHSV----LVGKSATKFAR 163
            |.:..:|:||||:||.:|||..::|::|.:.||..:|      |.:...:    |||:.|.::|.
  Rat   129 GEIECDASIMDGKSLSFGAVGALSGIKNPVSVAHRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAV 193

  Fly   164 SLGYKEEYLTDARTRNVLKKWRSNGCQPNFWRDVHPSPAENCGPYSPLPEHMHQHPMHQEYAIIQ 228
            ..|......:...||..|..::.|..:......|...       :..|...........:    .
  Rat   194 DHGIPSCPPSTMTTRFSLAAFKRNKRKLELAERVETD-------FIQLKRRRQSSAKEND----S 247

  Fly   229 GQHDQLAFLALDAEGKFHVASQSSGAQFRIPGRVGDSAVPGAGIYADNEVGGA--------VASG 285
            |..|.:..:.:|.||....|..|.|...:.|||||.:|:.|.|.:|:|.  ||        ..||
  Rat   248 GALDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENT--GAHNPYSTAVSTSG 310

  Fly   286 DGDVLMRHLPA----------------------------FLAVE-----------AMRAGKEPDK 311
            .|:.|:|.:.|                            |||.|           :.|...|.|.
  Rat   311 CGEHLVRTILARECSHALQAEDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCRCPSESDP 375

  Fly   312 AAE---LVVQRLLRHNTEFNGAVVVVNRRGIYAAACAGLDEFHFVVSGGKEYLSMARVERVKCLE 373
            :.:   |:|:.|..|:||               :.|.|    :.....||....::|:. ...:.
  Rat   376 SQDKQTLLVEFLWSHSTE---------------SMCVG----YMSAQDGKAKTHISRLP-PGAVA 420

  Fly   374 RENEVIDGG 382
            .::..|:||
  Rat   421 GQSVAIEGG 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 70/306 (23%)
Tasp1XP_017447248.1 Taspase1_like 42..434 CDD:271336 76/334 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.