DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4372 and Asrgl1

DIOPT Version :9

Sequence 1:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_659557.1 Gene:Asrgl1 / 246307 RGDID:708526 Length:333 Species:Rattus norvegicus


Alignment Length:314 Identity:81/314 - (25%)
Similarity:136/314 - (43%) Gaps:57/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TEIQSLLISTWNYTDANLQAWSVLQQGPRRTRQAVIQGCMACQNQRCGRLLTGRSSPDTEGALTL 113
            ||..::|.:..:..||...|.::|:..|.             .|...|.:|      :.:|.:.:
  Rat    55 TEGYNILKAGGSAVDAVEGAVTMLENDPE-------------FNAGYGSVL------NADGDIEM 100

  Fly   114 EAAIMDGESLEYGAVAGMNGVRNAILVADAVLKYTKHSVLVGKSATKFARSLGYKE---EYLTDA 175
            :|:||||:.|..|||:.:..:.|.:.:|..|::.|.|..|.|:.|.|||..:|..:   |.|...
  Rat   101 DASIMDGKDLSAGAVSAVRCIANPVKLARLVMEKTPHCFLTGRGAEKFAADMGIPQTPAEKLITE 165

  Fly   176 RTRNVLKKWR-SNGCQPNFWRDVHPSPAENCGPYSPLPEHMHQHPMHQEYAIIQGQHDQLAFLAL 239
            ||:..|:|.: ..|.|           ..:|...|                      ..:..:||
  Rat   166 RTKKHLEKEKLEKGAQ-----------KADCPKNS----------------------GTVGAVAL 197

  Fly   240 DAEGKFHVASQSSGAQFRIPGRVGDSAVPGAGIYADNEVGGAVASGDGDVLMRHLPAFLAVEAMR 304
            |.:|....|:.:.|...::.||||||...|||.||||.:|....:|.|:.:::...|.||:..:.
  Rat   198 DCKGNLAYATSTGGIVNKMVGRVGDSPCIGAGGYADNNLGAVSTTGHGESILKVNLARLALFHVE 262

  Fly   305 AGKEPDKAAELVVQRLLRHNTEFNGAVVVVNRRGIYAAACAGLDEFHFVVSGGK 358
            .||..|:||.|.:. .::...:..|.::::|:.|.:.|...........|..||
  Rat   263 QGKTVDEAATLALD-YMKSKLKGLGGLILINKTGDWVAKWTSASMPWAAVKNGK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 77/305 (25%)
Asrgl1NP_659557.1 ASRGL1_like 25..314 CDD:271338 79/311 (25%)
PRK10226 27..306 CDD:182319 78/303 (26%)
Substrate binding. /evidence=ECO:0000250 219..222 2/2 (100%)
Substrate binding. /evidence=ECO:0000250 242..245 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.