DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4372 and AGA

DIOPT Version :9

Sequence 1:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_000018.2 Gene:AGA / 175 HGNCID:318 Length:346 Species:Homo sapiens


Alignment Length:323 Identity:129/323 - (39%)
Similarity:195/323 - (60%) Gaps:9/323 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LLISTWNYTDANLQAWSVLQQGPRRTRQAVIQGCMACQNQRCGRLLTGRSSPDTEGALTLEAAIM 118
            |:::||.:.:|...||..|..| .....||..||..|:.::|...:....|||..|..||:|.||
Human    29 LVVNTWPFKNATEAAWRALASG-GSALDAVESGCAMCEREQCDGSVGFGGSPDELGETTLDAMIM 92

  Fly   119 DGESLEYGAVAGMNGVRNAILVADAVLKYTKHSVLVGKSATKFARSLGYKEEYLTDARTRNVLKK 183
            ||.:::.|||..:..::|||.||..||::|.|::|||:|||.||:|:|:..|.|:...::.:...
Human    93 DGTTMDVGAVGDLRRIKNAIGVARKVLEHTTHTLLVGESATTFAQSMGFINEDLSTTASQALHSD 157

  Fly   184 WRSNGCQPNFWRDVHPSPAENCGPYSPLPEHMHQH-PMHQEYAIIQGQHDQLAFLALDAEGKFHV 247
            |.:..||||:||:|.|.|::.||||.| |..:.|. |:|:|....:| ||.:..:.:...|....
Human   158 WLARNCQPNYWRNVIPDPSKYCGPYKP-PGILKQDIPIHKETEDDRG-HDTIGMVVIHKTGHIAA 220

  Fly   248 ASQSSGAQFRIPGRVGDSAVPGAGIYADNEVGGAVASGDGDVLMRHLPAFLAVEAMRAGKEPDKA 312
            .:.::|.:|:|.||||||.:||||.|||:..|.|.|:|:||:|||.||::.|||.||.|::|..|
Human   221 GTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIA 285

  Fly   313 AELVVQRLLRHNTEFNGAVVVVNRRGIYAAACAGLD---EFHFVVSGGKEYLSMARVERVKCL 372
            .:.|:.|:.:|..||.|||:..|..|.|.|||..|.   :|.|:|...::  :....|:|.|:
Human   286 CQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEK--NQPTEEKVDCI 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 126/305 (41%)
AGANP_000018.2 Glycosylasparaginase 29..332 CDD:271335 126/305 (41%)
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 234..237 2/2 (100%)
Substrate binding. /evidence=ECO:0000269|PubMed:8846222 257..260 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141713
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3395
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487354at2759
OrthoFinder 1 1.000 - - FOG0004212
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.