DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4372 and Aga

DIOPT Version :9

Sequence 1:NP_611615.1 Gene:CG4372 / 37490 FlyBaseID:FBgn0034665 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001005847.1 Gene:Aga / 11593 MGIID:104873 Length:346 Species:Mus musculus


Alignment Length:312 Identity:125/312 - (40%)
Similarity:182/312 - (58%) Gaps:19/312 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LLISTWNYTDANLQAWSVLQQGPRRTRQAVIQGCMACQNQRCGRLLTGRSSPDTEGALTLEAAIM 118
            |:::||.:.:|...||..|..| .....||..||..|:.::|...:....|||..|..||:|.||
Mouse    29 LVVNTWPFKNATEAAWWTLLSG-GSALDAVENGCAVCEKEQCDGTVGFGGSPDEGGETTLDAMIM 92

  Fly   119 DGESLEYGAVAGMNGVRNAILVADAVLKYTKHSVLVGKSATKFARSLGYKEEYLTDARTRNVLKK 183
            ||.:::.|||.|:..::|||.||..||::|.|::|||.||||||.|:|:..|.|:...:|::...
Mouse    93 DGTAMDVGAVGGLRRIKNAIGVARRVLEHTTHTLLVGDSATKFAESMGFTNEDLSTKTSRDLHSD 157

  Fly   184 WRSNGCQPNFWRDVHPSPAENCGPYSP-------LPEHMHQHPMHQEYAIIQGQHDQLAFLALDA 241
            |.|..||||:||:|.|.|::.||||.|       :..|..:..:|        .||.:..:.:..
Mouse   158 WLSRNCQPNYWRNVIPDPSKYCGPYKPSGFLKQSISPHKEEVDIH--------SHDTIGMVVIHK 214

  Fly   242 EGKFHVASQSSGAQFRIPGRVGDSAVPGAGIYADNEVGGAVASGDGDVLMRHLPAFLAVEAMRAG 306
            .|.....:.::|.:|:||||||||.:||||.|||:..|.|.|:||||.|:|.||::.|||.||.|
Mouse   215 TGHTAAGTSTNGIKFKIPGRVGDSPIPGAGAYADDTAGAAAATGDGDTLLRFLPSYQAVEYMRGG 279

  Fly   307 KEPDKAAELVVQRLLRHNTEFNGAVVVVNRRGIYAAACAGL---DEFHFVVS 355
            .:|..|.:.|:.|:.::...|.|||:..:..|.|.|||..|   .:|.|:||
Mouse   280 DDPAIACQKVILRIQKYYPNFFGAVICASVNGSYGAACNKLPTFTQFSFMVS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4372NP_611615.1 Glycosylasparaginase 54..356 CDD:271335 125/312 (40%)
AgaNP_001005847.1 Glycosylasparaginase 29..332 CDD:271335 125/312 (40%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P20933 234..237 2/2 (100%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P20933 257..260 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831663
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3395
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004212
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.750

Return to query results.
Submit another query.